PDB entry 1mhz

View 1mhz on RCSB PDB site
Description: methane monooxygenase hydroxylase
Class: oxidoreductase
Keywords: oxidoreductase, monooxygenase, nadp, one-carbon metabolism
Deposited on 1996-10-21, released 1997-05-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.152
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: methane monooxygenase hydroxylase
    Species: Methylosinus trichosporium [TaxId:426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27354
      • conflict (254-255)
      • insertion (347)
      • conflict (348-349)
      • conflict (351-352)
      • conflict (355-356)
      • conflict (358)
      • conflict (360-361)
      • insertion (363-367)
      • conflict (368)
      • insertion (370)
      • conflict (371)
      • engineered insertion (372)
    Domains in SCOPe 2.01: d1mhzb_
  • Chain 'D':
    Compound: methane monooxygenase hydroxylase
    Species: Methylosinus trichosporium [TaxId:426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27353 (Start-520)
      • conflict (31)
      • conflict (189)
      • conflict (203-204)
      • conflict (219-220)
      • insertion (323)
      • conflict (325)
      • conflict (351)
    Domains in SCOPe 2.01: d1mhzd_
  • Chain 'G':
    Compound: methane monooxygenase hydroxylase
    Species: Methylosinus trichosporium [TaxId:426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27355
      • conflict (87)
      • conflict (108-109)
      • conflict (159)
    Domains in SCOPe 2.01: d1mhzg_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mhzB (B:)
    msqpqssqvtkrgltdperaaiiaaavpdhaldtqrkyhyfiqprwkplseyeqlscyaq
    pnpdwiaggldwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseea
    rytqrflaayssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirq
    tavfaaldkvdnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqg
    vqdwneilwaghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaidd
    lfvyclandsefgahnrtflnawtehylassvaalkdfvglyakvekvagatdsagvsea
    lqrvfgdwkidyadkigfrvdvdqkvdavlagykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhzB (B:)
    krgltdperaaiiaaavpdhaldtqrkyhyfiqprwkplseyeqlscyaqpnpdwiaggl
    dwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearytqrflaay
    ssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtavfaaldkv
    dnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqdwneilwa
    ghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfvyclands
    efgahnrtflnawtehylassvaalkdfvglyakvekvagatdsagvsealqrvfgdwki
    dyadkigfrvdvdqkvdavlagy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mhzD (D:)
    maislatkaatnrapvgvepqevhkwlqsfnwdfkenrtkyptkyhmanetkeqfkviak
    eyarmeaakderqfgtlldgltrlgagnkvhprwgetmkvisnflevgeynaiaasamlw
    dsataaeqkngylaqvldeirhthqcafinhyyskhyhdpaghndarrtraigplwkgmk
    rvfadgfisgdavecsvnlqlvgeacftnplivavtewasangdeitptvflsvetdelr
    hmangyqtvvsiandpasakflntdlnnafwtqqkyftpvlgylfeygskfkvepwvktw
    nrwvsedwggiwigrlgkygvesprslrdakrdaywahhdlalaayamwplgfarlalpd
    eedqawfeanypgwadhygkifnewkklgyedpksgfipyqwllanghdvyidrvsqvpf
    ipslakgtgslrvhefngkkhsltddwgerqwlieperyechnvfeqyegrelseviaeg
    hgvrsdgktliaqphtrgdnlwtledikragcvfpdplakf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhzD (D:)
    nrapvgvepqevhkwlqsfnwdfkenrtkyptkyhmanetkeqfkviakeyarmeaakde
    rqfgtlldgltrlgagnkvhprwgetmkvisnflevgeynaiaasamlwdsataaeqkng
    ylaqvldeirhthqcafinhyyskhyhdpaghndarrtraigplwkgmkrvfadgfisgd
    avecsvnlqlvgeacftnplivavtewasangdeitptvflsvetdelrhmangyqtvvs
    iandpasakflntdlnnafwtqqkyftpvlgylfeygskfkvepwvktwnrwvsedwggi
    wigrlgkygvesprslrdakrdaywahhdlalaayamwplgfarlalpdeedqawfeany
    pgwadhygkifnewkklgyedpksgfipyqwllanghdvyidrvsqvpfipslakgtgsl
    rvhefngkkhsltddwgerqwlieperyechnvfeqyegrelseviaeghgvrsdgktli
    aqphtrgdnlwtledikragcvfpdplakf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1mhzG (G:)
    makrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierk
    ieeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaeaihiefrqlyk
    ppvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhzG (G:)
    akrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierki
    eeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaeaihiefrqlykp
    pvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlq