PDB entry 1mhh

View 1mhh on RCSB PDB site
Description: structure of p. magnus protein l mutant bound to a mouse fab
Deposited on 2002-08-20, released 2003-01-14
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-14, with a file datestamp of 2003-01-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhhA (A:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnex
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mhhB (B:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhhB (B:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhhC (C:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnex
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mhhD (D:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mhhD (D:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhhE (E:)
    evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngewtadledggnhmnikf
    agk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhhF (F:)
    evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngewtadledggnhmnikf
    ag