PDB entry 1mg9

View 1mg9 on RCSB PDB site
Description: the structural basis of clps-mediated switch in clpa substrate recognition
Deposited on 2002-08-15, released 2002-11-27
The last revision prior to the SCOP 1.65 freeze date was dated 2002-11-27, with a file datestamp of 2002-11-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.252
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1mg9a_
  • Chain 'B':
    Domains in SCOP 1.65: d1mg9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mg9A (A:)
    mgktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratq
    lmlavayqgkaicgvftaevaetkvamvnkyarenehpllctleka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg9A (A:)
    kppsmykvilvnddytpmefvidvlqkffsydveratqlmlavayqgkaicgvftaevae
    tkvamvnkyarenehpllctleka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mg9B (B:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgtrkde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mg9B (B:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpasrdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqaayl
    lrkhevsrldvvnfishgtrkde