PDB entry 1mg8

View 1mg8 on RCSB PDB site
Description: NMR structure of ubiquitin-like domain in murine Parkin
Class: apoptosis
Keywords: parkinson disease, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, APOPTOSIS
Deposited on 2002-08-15, released 2003-04-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parkin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WVS6 (2-77)
      • initiating met (0)
      • cloning artifact (1)
    Domains in SCOPe 2.04: d1mg8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mg8A (A:)
mgmivfvrfnssygfpvevdsdtsilqlkevvakrqgvpadqlrvifagkelpnhltvqn
cdleqqsivhivqrprrr