PDB entry 1mfm

View 1mfm on RCSB PDB site
Description: monomeric human sod mutant f50e/g51e/e133q at atomic resolution
Class: oxidoreductase
Keywords: oxidoreductase, superoxide acceptor, monomeric mutant
Deposited on 1999-04-16, released 1999-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: N/A
AEROSPACI score: -1.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (copper,zinc superoxide dismutase)
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (49-50)
      • engineered (110)
      • engineered (132)
    Domains in SCOPe 2.07: d1mfma_
  • Heterogens: ZN, CU, CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mfmA (A:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneqstktgnagsrlacgvigiaq