PDB entry 1mfa

View 1mfa on RCSB PDB site
Description: structure of a single-chain fv fragment complexed with a carbohydrate antigen at 1.7 angstroms resolution
Deposited on 1993-10-25, released 1994-01-31
The last revision prior to the SCOP 1.65 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.166
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1mfa_ (-)
    qivvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
    parfsgsligdkaaltitgaqpedeaiyfcalwsnnhwifgggtkltvlgqpksspsvtl
    fppssegevqvqqsgtvvarpgasvkmsckasgytftnywmhwikqrpgqglewigaiyp
    gnsatfynhkfraktkltavtstttaymelssltsedsavyyctrgghgyygdywgqgas
    ltvssak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mfa_ (-)
    qivvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
    parfsgsligdkaaltitgaqpedeaiyfcalwsnnhwifgggtkltvlgqpgevqvqqs
    gtvvarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfynhkfrak
    tkltavtstttaymelssltsedsavyyctrgghgyygdywgqgasltvs