PDB entry 1mdt

View 1mdt on RCSB PDB site
Description: the refined structure of monomeric diphtheria toxin at 2.3 angstroms resolution
Deposited on 1994-03-21, released 1994-07-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mdtA (A:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
    daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
    eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
    ymaqacagnrvrrsvgsslscinldwdvirdktktkieslkehgpiknkmsespnktvse
    ekakqyleefhqtalehpelselktvtgtnpvfaganyaawavnvaqvidsetadnlekt
    taalsilpgigsvmgiadgavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynf
    vesiinlfqvvhnsynrpayspghktqpflhdgyavswntvedsiirtgfqgesghdiki
    taentplpiagvllptipgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvg
    ngvhanlhvafhrsssekihsneissdsigvlgyqktvdhtkvnsklslffeiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mdtA (A:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
    daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
    eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
    ymaqacascinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhq
    talehpelselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigs
    vmgiadgavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvh
    nsynrpayspghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagv
    llptipgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafh
    rsssekihsneissdsigvlgyqktvdhtkvnsklslffeiks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mdtB (B:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
    daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
    eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
    ymaqacagnrvrrsvgsslscinldwdvirdktktkieslkehgpiknkmsespnktvse
    ekakqyleefhqtalehpelselktvtgtnpvfaganyaawavnvaqvidsetadnlekt
    taalsilpgigsvmgiadgavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynf
    vesiinlfqvvhnsynrpayspghktqpflhdgyavswntvedsiirtgfqgesghdiki
    taentplpiagvllptipgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvg
    ngvhanlhvafhrsssekihsneissdsigvlgyqktvdhtkvnsklslffeiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mdtB (B:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
    daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
    eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
    ymaqacascinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhq
    talehpelselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigs
    vmgiadgavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvh
    nsynrpayspghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagv
    llptipgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafh
    rsssekihsneissdsigvlgyqktvdhtkvnsklslffeiks