PDB entry 1mdi

View 1mdi on RCSB PDB site
Description: high resolution solution nmr structure of mixed disulfide intermediate between mutant human thioredoxin and a 13 residue peptide comprising its target site in human nfkb
Class: complex (electron transport/peptide)
Keywords: complex (electron transport/peptide)
Deposited on 1995-02-27, released 1995-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10599 (1-104)
    • conflict (34)
    • conflict (61)
    • conflict (68)
    • conflict (72-73)
  Domains in SCOPe 2.05: d1mdia_
• Chain 'B':
  Compound: target site in human nfkb
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19838 (0-12)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mdiA (A:)
  mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
  daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv
  

  
  
• Chain 'B':
  No sequence available.