PDB entry 1mdi

View 1mdi on RCSB PDB site
Description: high resolution solution nmr structure of mixed disulfide intermediate between mutant human thioredoxin and a 13 residue peptide comprising its target site in human nfkb
Deposited on 1995-02-27, released 1995-06-03
The last revision prior to the SCOP 1.71 freeze date was dated 1995-06-03, with a file datestamp of 1995-06-03.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1mdia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mdiA (A:)
  mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
  daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv