PDB entry 1md8

View 1md8 on RCSB PDB site
Description: Monomeric structure of the active catalytic domain of complement protease C1r
Class: Hydrolase
Keywords: complement, innate immunity, serine protease, activation, substrate specificity, Hydrolase
Deposited on 2002-08-07, released 2003-08-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c1r complement serine protease
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1md8a1, d1md8a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1md8A (A:)
    dcgqprnlpngdfrytttmgvntykariqyychepyykmqtragsreseqgvytctaqgi
    wkneqkgekiprclpvcgkpvnpveqrqriiggqkakmgnfpwqvftnihgrgggallgd
    rwiltaahtlypkeheaqsnasldvflghtnveelmklgnhpirrvsvhpdyrqdesynf
    egdiallelensvtlgpnllpiclpdndtfydlglmgyvsgfgvmeekiahdlrfvrlpv
    anpqacenwlrgknrmdvfsqnmfcaghpslkqdacqgdsggvfavrdpntdrwvatgiv
    swgigcsrgygfytkvlnyvdwikkemee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1md8A (A:)
    dcgqprnlpngdfrytttmgvntykariqyychepyykmqtqgvytctaqgiwkneqkge
    kiprclpvcgkpvnpveqriiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtl
    ypkehasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtl
    gpnllpiclpdndtfydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknr
    mdvfsqnmfcaghpslkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytk
    vlnyvdwikkemee