PDB entry 1md7

View 1md7 on RCSB PDB site
Description: Monomeric structure of the zymogen of complement protease C1r
Class: Hydrolase
Keywords: complement, innate immunity, serine protease, activation, substrate specificity, Hydrolase
Deposited on 2002-08-07, released 2003-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.217
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c1r complement serine protease
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00736 (0-327)
      • engineered (279)
    Domains in SCOPe 2.07: d1md7a1, d1md7a2
  • Heterogens: NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1md7A (A:)
    dcgqprnlpngdfrytttmgvntykariqyychepyykmqtragsreseqgvytctaqgi
    wkneqkgekiprclpvcgkpvnpveqrqriiggqkakmgnfpwqvftnihgrgggallgd
    rwiltaahtlypkeheaqsnasldvflghtnveelmklgnhpirrvsvhpdyrqdesynf
    egdiallelensvtlgpnllpiclpdndtfydlglmgyvsgfgvmeekiahdlrfvrlpv
    anpqacenwlrgknrmdvfsqnmfcaghpslkqdacqgdaggvfavrdpntdrwvatgiv
    swgigcsrgygfytkvlnyvdwikkeme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1md7A (A:)
    dcgqprnlpngdfrytttmgvntykariqyychepyykmqtqgvytctaqgiwkneqkge
    kiprclpvcgkpvnpveiiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlyp
    keheaqsnasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelens
    vtlgpnllpiclpdndtfydlglmgyvsgfgahdlrfvrlpvanpqacenwldvfsqnmf
    caghpslkqdacqgdaggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwik
    keme