PDB entry 1md4

View 1md4 on RCSB PDB site
Description:
Deposited on 2002-08-06, released 2002-08-21
The last revision prior to the SCOP 1.67 freeze date was dated 2003-07-22, with a file datestamp of 2003-07-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.207
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1md4a1, d1md4a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1md4b1, d1md4b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1md4A (A:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivvdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1md4A (A:)
    pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
    lyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvka
    lpgqlkpfetllsqnqggktfivvdqisfadynlldlllihevlapgcldafpllsayvg
    rlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1md4B (B:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivvdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1md4B (B:)
    pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
    lyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvka
    lpgqlkpfetllsqnqggktfivvdqisfadynlldlllihevlapgcldafpllsayvg
    rlsarpklkaflaspeyvnlpingngkq