PDB entry 1md3

View 1md3 on RCSB PDB site
Description: A folding mutant of human class pi glutathione transferase, created by mutating glycine 146 of the wild-type protein to alanine
Deposited on 2002-08-06, released 2002-08-21
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-21, with a file datestamp of 2002-08-21.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.181
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1md3A (A:)
    pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
    lyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvka
    lpgqlkpfetllsqnqggktfivadqisfadynlldlllihevlapgcldafpllsayvg
    rlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1md3B (B:)
    pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
    lyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvka
    lpgqlkpfetllsqnqggktfivadqisfadynlldlllihevlapgcldafpllsayvg
    rlsarpklkaflaspeyvnlpingngkq