PDB entry 1mcy

View 1mcy on RCSB PDB site
Description: sperm whale myoglobin (mutant with initiator met and with his 64 replaced by gln, leu 29 replaced by phe
Deposited on 1995-07-19, released 1995-12-07
The last revision prior to the SCOP 1.57 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1mcy__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mcy_ (-)
  mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
  dlkkqgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgdfgadaqgamnkalelfrkdiaakykelgyqg