PDB entry 1mcw

View 1mcw on RCSB PDB site
Description: three-dimensional structure of a hybrid light chain dimer. protein engineering of a binding cavity
Deposited on 1989-05-09, released 1990-10-15
The last revision prior to the SCOP 1.59 freeze date was dated 1990-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3.5 Å
R-factor: 0.17
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcwM (M:)
    esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
    pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcwW (W:)
    esaltqpasvsgspgqsitvscaghtsdvadsnsiswfqqhpdkapklliyavtfrpsgi
    plrfsgsksgntasltisgllpddeadyfcmsylsdasfvfgsgtkvtvlrqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspveagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs