PDB entry 1mct
View 1mct on RCSB PDB site
Description: the refined 1.6 angstroms resolution crystal structure of the complex formed between porcine beta-trypsin and mcti-a, a trypsin inhibitor of squash family
Class: complex(proteinase/inhibitor)
Keywords: complex(proteinase/inhibitor)
Deposited on
1992-10-24, released
1994-01-15
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.167
AEROSPACI score: 0.6
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: beta-trypsin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
- Uniprot P00761 (0-222)
- conflict (144)
- conflict (166)
Domains in SCOPe 2.03: d1mcta_ - Chain 'I':
Compound: trypsin inhibitor a
Species: Momordica charantia [TaxId:3673]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1mcti_ - Heterogens: CA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1mctA (A:)
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
wgntkssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggp
vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>1mctI (I:)
ricpriwmectrdsdcmakcicvaghcg