PDB entry 1mct

View 1mct on RCSB PDB site
Description: the refined 1.6 angstroms resolution crystal structure of the complex formed between porcine beta-trypsin and mcti-a, a trypsin inhibitor of squash family
Class: complex(proteinase/inhibitor)
Keywords: complex(proteinase/inhibitor)
Deposited on 1992-10-24, released 1994-01-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.167
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-trypsin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00761 (0-222)
      • conflict (144)
      • conflict (166)
    Domains in SCOPe 2.02: d1mcta_
  • Chain 'I':
    Compound: trypsin inhibitor a
    Species: Momordica charantia [TaxId:3673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30709 (0-27)
      • conflict (1)
    Domains in SCOPe 2.02: d1mcti_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mctA (A:)
    ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
    neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
    wgntkssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggp
    vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mctI (I:)
    ricpriwmectrdsdcmakcicvaghcg