PDB entry 1mcp

View 1mcp on RCSB PDB site
Description: phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms
Deposited on 1984-07-09, released 1985-01-02
The last revision prior to the SCOP 1.71 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcpH (H:)
    evklvesggglvqpggslrlscatsgftfsdfymewvrqppgkrlewiaasrnkgnkytt
    eysasvkgrfivsrdtsqsilylqmnalraedtaiyycarnyygstwyfdvwgagttvtv
    ssesarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppala
    sggrytmsnqltlpavecpegesvkcsvqhdsnpvqeldvnc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mcpL (L:)
    divmtqspsslsvsagervtmsckssqsllnsgnqknflawyqqkpgqppklliygastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec