PDB entry 1mc6

View 1mc6 on RCSB PDB site
Description: Solution NMR Structure of AGRP(87-120; C105A)
Deposited on 2002-08-05, released 2002-08-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-28, with a file datestamp of 2002-08-28.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1mc6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mc6A (A:)
    cvrlhesclgqqvpccdpaatcycrffnafcycr