PDB entry 1mbx

View 1mbx on RCSB PDB site
Description: CRYSTAL STRUCTURE ANALYSIS OF ClpSN WITH TRANSITION METAL ION BOUND
Class: protein binding
Keywords: Protein binding, Adaptors, Hsp100/Clp chaperone, AAA+ family, ATP-dependent protease
Deposited on 2002-08-03, released 2002-12-11
The last revision prior to the SCOP 1.75 freeze date was dated 2002-12-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-Dependent clp Protease ATP-Binding Subunit clp A
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1mbxa_
  • Chain 'B':
    Compound: ATP-Dependent clp Protease ATP-Binding Subunit clp A
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1mbxb_
  • Chain 'C':
    Compound: Protein yljA
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1mbxc_
  • Chain 'D':
    Compound: Protein yljA
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1mbxd_
  • Heterogens: CL, ZN, YBT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbxA (A:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbxB (B:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mbxC (C:)
    mgktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratq
    lmlavhyqgkaicgvftaevaetkvamvnkyarenehpllctleka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mbxC (C:)
    dalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftae
    vaetkvamvnkyarenehpllctleka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mbxD (D:)
    mgktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratq
    lmlavhyqgkaicgvftaevaetkvamvnkyarenehpllctleka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mbxD (D:)
    alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev
    aetkvamvnkyarenehpllctleka