PDB entry 1mbx

View 1mbx on RCSB PDB site
Description: crystal structure analysis of clpsn with transition metal ion bound
Deposited on 2002-08-03, released 2002-12-11
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.208
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1mbxa_
  • Chain 'B':
    Domains in SCOP 1.63: d1mbxb_
  • Chain 'C':
    Domains in SCOP 1.63: d1mbxc_
  • Chain 'D':
    Domains in SCOP 1.63: d1mbxd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbxA (A:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbxB (B:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbxC (C:)
    dalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftae
    vaetkvamvnkyarenehpllctleka
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbxD (D:)
    alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev
    aetkvamvnkyarenehpllctleka