PDB entry 1mbu

View 1mbu on RCSB PDB site
Description: Crystal Structure Analysis of ClpSN heterodimer
Deposited on 2002-08-03, released 2002-12-11
The last revision prior to the SCOP 1.65 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1mbua_
  • Chain 'B':
    Domains in SCOP 1.65: d1mbub_
  • Chain 'C':
    Domains in SCOP 1.65: d1mbuc_
  • Chain 'D':
    Domains in SCOP 1.65: d1mbud_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbuA (A:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbuB (B:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mbuC (C:)
    mgktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratq
    lmlavhyqgkaicgvftaevaetkvamvnkyarenehpllctleka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mbuC (C:)
    alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev
    aetkvamvnkyarenehpllctleka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mbuD (D:)
    mgktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratq
    lmlavhyqgkaicgvftaevaetkvamvnkyarenehpllctleka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mbuD (D:)
    alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev
    aetkvamvnkyarenehpllctleka