PDB entry 1mbt

View 1mbt on RCSB PDB site
Description: oxidoreductase
Class: oxidoreductase
Keywords: flavoenzyme, oxidoreductase
Deposited on 1995-11-28, released 1996-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.209
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridine diphospho-n-acetylenolpyruvylglucosamine reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mbta1, d1mbta2
  • Heterogens: SO4, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mbtA (A:)
    mnhslkpwntfgidhnaqhivcaedeqqllnawqyataegqpvlilgegsnvlfledyrg
    tviinrikgieihdepdawylhvgagenwhrlvkytlqegmpglenlalipgcvgsspiq
    nigaygvelqrvcayvdsvelatgkqvrltakecrfgyrdsifkheyqdrfaivavglrl
    pkewqpvltygdltrldpttvtpqqvfnavchmrttklpdpkvngnagsffknpvvsaet
    akallsqfptapnypqadgsvklaagwlidqcqlkgmqiggaavhrqqalvlinednaks
    edvvqlahhvrqkvgekfnvwlepevrfigasgevsavetis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mbtA (A:)
    hslkpwntfgidhnaqhivcaedeqqllnawqyataegqpvlilgegsnvlfledyrgtv
    iinrikgieihdepdawylhvgagenwhrlvkytlqegmpglenlalipgcvgsspiqni
    gaygvelqrvcayvdsvelatgkqvrltakecrfgyrdsifkheyqdrfaivavglrlpk
    ewqpvltygdltrldpttvtpqqvfnavchmrttklpdpkvngnagsffknpvvsaetak
    allsqfptapnypqadgsvklaagwlidqcqlkgmqiggaavhrqqalvlinednaksed
    vvqlahhvrqkvgekfnvwlepevrfigasgevsavetis