PDB entry 1mbo

View 1mbo on RCSB PDB site
Description: Structure and refinement of oxymyoglobin at 1.6 angstroms resolution
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1981-08-27, released 1982-02-03
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1mboa_
  • Heterogens: SO4, HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mboA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg