PDB entry 1mbh

View 1mbh on RCSB PDB site
Description: mouse c-myb DNA-binding domain repeat 2
Class: DNA-binding protein
Keywords: protooncogene product
Deposited on 1995-05-19, released 1995-09-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR50
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-myb
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1mbha_
  • Heterogens: NH2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbhA (A:)
    likgpwtkeedqrvielvqkygpkrwsviakhlkgrigkqcrerwhnhlnpe