PDB entry 1mba

View 1mba on RCSB PDB site
Description: aplysia limacina myoglobin. crystallographic analysis at 1.6 angstroms resolution
Deposited on 1989-02-22, released 1990-01-15
The last revision prior to the SCOP 1.57 freeze date was dated 1992-04-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.193
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1mba__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mba_ (-)
    slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
    rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
    appagadaawtklfgliidalkaaga