PDB entry 1mam

View 1mam on RCSB PDB site
Description: crystal structure to 2.45 a resolution of a monoclonal fab specific for the brucella a cell wall polysaccharide antigen
Deposited on 1992-01-14, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.45 Å
R-factor: 0.215
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mamH (H:)
    evklvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkadgytt
    eysasvkgrftisrdnsqsilylqmntlraedsatyyctrdpygpaaywgqgtlvtvsaa
    kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
    ytmsssvtvpsstwpsqtvtcsvahpassttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mamL (L:)
    diqmtqttsslsaslgdrvtiscrasqdiynylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnlnqedmatyicqqgntlpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec