PDB entry 1mak

View 1mak on RCSB PDB site
Description: solution structure of an isolated antibody vl domain
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-09-16, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg2a-kappa 26-10 fv (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1maka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1makA (A:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikr