PDB entry 1maj

View 1maj on RCSB PDB site
Description: solution structure of an isolated antibody vl domain
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-09-16, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg2a-kappa 26-10 fv (light chain)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1maja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1majA (A:)
dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikr