PDB entry 1mab

View 1mab on RCSB PDB site
Description: rat liver f1-atpase
Deposited on 1998-08-06, released 1998-09-30
The last revision prior to the SCOP 1.63 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: -1.82 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mabA (A:)
    ssileerilgadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlep
    dnvgvvvfgndklikegdivkrtgaivdvpvgdellgrvvdalgnaidgkgpvgskirrr
    vglkapgiiprisvrepmqtgikavdslvpigrgqreliigdrqtgktsiaidtiinqkr
    fndgtdekkklyciyvaigqkrstvaqlvkrltdadamkytivvsatasdaaplqylapy
    sgcsmgeyfrdngkhaliiyddlskqavayrqmslllrrppgreaypgdvfylhsrller
    aakmndsfgggsltalpvietqagdvsayiptnvisitdgqifletelfykgirpainvg
    lsvsrvgsaaqtramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltell
    kqgqyspmaieeqvaviyagvrgyldklepskitkfesaflshvvsqhqsllgnirtdgk
    iseqsdaklkeivtnflagfep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mabA (A:)
    ssileerigadtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepd
    nvgvvvfgndklikegdivkrtgaivdvpvgdellgrvvdalgnaidgkgpvgskirrrv
    glkapgiiprisvrepmqtgikavdslvpigrgqreliigdrqtgktsiaidtiinqkrf
    ndgtdekkklyciyvaigqkrstvaqlvkrltdadamkytivvsatasdaaplqylapys
    gcsmgeyfrdngkhaliiyddlskqavayrqmslllrrppgreaypgdvfylhsrllera
    akmndsfgggsltalpvietqagdvsayiptnvisitdgqifletelfykgirpainvgl
    svsrvgsaaqtramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellk
    qgqyspmaieeqvaviyagvrgyldklepskitkfesaflshvvsqhqsllgnirtdgki
    seqsdaklkeivtnflagfep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mabB (B:)
    saapkagtatgqivavigavvdvqfdeglppilnalevqgresrlvlevaqhlgestvrt
    iamdgteglvrgqkvldsgapikipvgpetlgrimnvigepidergpiktkqfapihaea
    pefiemsveqeilvtgikvvdllapyakggkiglfggagvgktvlimelinnvakahggy
    svfagvgertregndlyhemiesgvinlkdatskvalvygqmneppgararvaltgltva
    eyfrdqegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgtmqeritttk
    kgsitsvqaiyvpaddltdpapattfahldattvlsraiaelgiypavdpldstsrimdp
    nivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqpfqv
    aevftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1mabG (G:)
    rditrrlksikniqkitksmkmvaaakyaraerelkparvygtgslalyekaeikgpedk
    kkhliigvssdrglcgaihssvakqmkndmaaltaagkevmivgigekiksilyrthsdq
    flvsfkdvgrkpptfgdasvialellnsgyefdegsiifnqfksvisykteekpifsfst
    vvaaenmsiyddidadvlqnyqeynlaniiyyslkesttseqsarmtamdnasknasdmi
    dkltltfnrtrqavitkelieiisgaaald
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mabG (G:)
    rditrrlksikniqkitksmkmvaaakyaraerelkparvygtgslcgaihssvakqmkl
    aniiyyslkesttseqsarmtamdnasknasdmidkltltfnrtrqavitkelieiisga
    aald