PDB entry 1maa

View 1maa on RCSB PDB site
Description: mouse acetylcholinesterase catalytic domain, glycosylated protein
Class: hydrolase
Keywords: hydrolase, serine esterase, acetylcholinesterase, tetramer, hydrolase fold, glycosylated protein
Deposited on 1998-11-04, released 1999-04-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.2
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: MOUSE ACHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21836
      • conflict (494)
    Domains in SCOPe 2.02: d1maaa_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: MOUSE ACHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21836
      • conflict (494)
    Domains in SCOPe 2.02: d1maab_
  • Chain 'C':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: MOUSE ACHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21836 (0-546)
      • conflict (494)
    Domains in SCOPe 2.02: d1maac_
  • Chain 'D':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: MOUSE ACHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21836
      • conflict (494)
    Domains in SCOPe 2.02: d1maad_
  • Heterogens: NAG, PO4, DME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1maaA (A:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
    pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
    agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
    qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
    tnfartgdpndprdrkspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    satdtld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1maaA (A:)
    edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
    tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
    ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
    qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
    arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
    dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
    rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
    rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
    artgdpndprdrkspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1maaB (B:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
    pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
    agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
    qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
    tnfartgdpndprdrkspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    satdtld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1maaB (B:)
    redpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvlda
    ttfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyggg
    fysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqw
    vqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsag
    earrratllarlvgcndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdfls
    dtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigvpq
    asdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayi
    fehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgdp
    ndprdrkspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsatdt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1maaC (C:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
    pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
    agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
    qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
    tnfartgdpndprdrkspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    satdtld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1maaC (C:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdf
    lsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigv
    pqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvya
    yifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartg
    dpndprdrkspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsatdtld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1maaD (D:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
    pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
    agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
    qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
    tnfartgdpndprdrkspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    satdtld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1maaD (D:)
    edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
    tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
    ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
    qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
    arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
    dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
    rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
    rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
    artgdpndprdrkspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat
    d