PDB entry 1m9y

View 1m9y on RCSB PDB site
Description: X-ray crystal structure of Cyclophilin A/HIV-1 CA N-terminal domain (1-146) M-type H87A,G89A Complex.
Deposited on 2002-07-30, released 2003-05-27
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-24, with a file datestamp of 2003-06-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.169
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1m9ya_
  • Chain 'B':
    Domains in SCOP 1.65: d1m9yb_
  • Chain 'C':
    Domains in SCOP 1.65: d1m9yc_
  • Chain 'D':
    Domains in SCOP 1.65: d1m9yd_
  • Chain 'E':
    Domains in SCOP 1.65: d1m9ye_
  • Chain 'F':
    Domains in SCOP 1.65: d1m9yf_
  • Chain 'G':
    Domains in SCOP 1.65: d1m9yg_
  • Chain 'H':
    Domains in SCOP 1.65: d1m9yh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m9yA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m9yB (B:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m9yB (B:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m9yC (C:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvaaapiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1m9yD (D:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvaaapiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m9yD (D:)
    hqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlke
    tineeaaewdrlhpvaaapiapgqmreprgsdiagttstlqeqigwmthnppipvgeiyk
    rwiilglnkivrmys
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m9yE (E:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1m9yF (F:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m9yF (F:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m9yG (G:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvaaapiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1m9yH (H:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvaaapiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m9yH (H:)
    hqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlke
    tineeaaewdrlhpvaaapiapgqmreprgsdiagttstlqeqigwmthnppipvgeiyk
    rwiilglnkivrmys