PDB entry 1m9d

View 1m9d on RCSB PDB site
Description: X-ray crystal structure of Cyclophilin A/HIV-1 CA N-terminal domain (1-146) O-type chimera Complex.
Class: Isomerase/Viral protein
Keywords: CAPSID, HIV-1, CYCLOPHILIN A, ISOMERASE, ROTAMASE, Isomerase/Viral protein COMPLEX
Deposited on 2002-07-28, released 2003-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m9da_
  • Chain 'B':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m9db_
  • Chain 'C':
    Compound: hiv-1 capsid
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: CA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72497 (0-145)
      • engineered (82)
      • engineered (85-87)
      • engineered (90-91)
      • engineered (95)
      • see remark 999 (119)
    Domains in SCOPe 2.07: d1m9dc_
  • Chain 'D':
    Compound: hiv-1 capsid
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: CA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72497 (0-145)
      • engineered (82)
      • engineered (85-87)
      • engineered (90-91)
      • engineered (95)
      • see remark 999 (119)
    Domains in SCOPe 2.07: d1m9dd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m9dA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m9dB (B:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m9dB (B:)
    nptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfmc
    qggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktewl
    dgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m9dC (C:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrthppamgplppgqireprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m9dD (D:)
    pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrthppamgplppgqireprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmys