PDB entry 1m94

View 1m94 on RCSB PDB site
Description: Solution Structure of the Yeast Ubiquitin-Like Modifier Protein Hub1
Class: structural genomics, signaling protein
Keywords: ubiquitin-like fold or beta-grasp fold, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, SIGNALING PROTEIN
Deposited on 2002-07-26, released 2002-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: 0.14
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein YNR032c-a
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: YNR032c-a/HUB1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6Q546 (20-92)
  Domains in SCOPe 2.08: d1m94a_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1m94A (A:)
  mgsshhhhhhssglvprgshmievvvndrlgkkvrvkclaedsvgdfkkvlslqigtqpn
  kivlqkggsvlkdhisledyevhdqtnlelyyl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1m94A (A:)
  mievvvndrlgkkvrvkclaedsvgdfkkvlslqigtqpnkivlqkggsvlkdhisledy
  evhdqtnlelyyl