PDB entry 1m8p

View 1m8p on RCSB PDB site
Description: Crystal Structure of P. chrysogenum ATP Sulfurylase in the T-state
Deposited on 2002-07-25, released 2002-11-27
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-27, with a file datestamp of 2002-11-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8pA (A:)
    manaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmn
    qadydrvcednrladgnvfsmpitldasqevidekklqaasritlrdfrddrnlailtid
    diyrpdktkeaklvfggdpehpaivylnntvkefyiggkieavnklnhydyvalrytpae
    lrvhfdklgwsrvvafqtrnpmhrahreltvraarsrqanvlihpvvgltkpgdidhftr
    vrayqallprypngmavlgllglamrmggpreaiwhaiirknhgathfivgrdhagpgsn
    skgedfygpydaqhavekykdelgievvefqmvtylpdtdeyrpvdqvpagvktlnisgt
    elrrrlrsgahipewfsypevvkilresnppratqgftifltgymnsgkdaiaralqvtl
    nqqggrsvslllgdtvrhelsselgftredrhtniqriafvateltragaaviaapiapy
    eesrkfardavsqagsfflvhvatplehceqsdkrgiyaaarrgeikgftgvddpyetpe
    kadlvvdfskqsvrsivheiilvlesqgflerq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8pB (B:)
    manaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmn
    qadydrvcednrladgnvfsmpitldasqevidekklqaasritlrdfrddrnlailtid
    diyrpdktkeaklvfggdpehpaivylnntvkefyiggkieavnklnhydyvalrytpae
    lrvhfdklgwsrvvafqtrnpmhrahreltvraarsrqanvlihpvvgltkpgdidhftr
    vrayqallprypngmavlgllglamrmggpreaiwhaiirknhgathfivgrdhagpgsn
    skgedfygpydaqhavekykdelgievvefqmvtylpdtdeyrpvdqvpagvktlnisgt
    elrrrlrsgahipewfsypevvkilresnppratqgftifltgymnsgkdaiaralqvtl
    nqqggrsvslllgdtvrhelsselgftredrhtniqriafvateltragaaviaapiapy
    eesrkfardavsqagsfflvhvatplehceqsdkrgiyaaarrgeikgftgvddpyetpe
    kadlvvdfskqsvrsivheiilvlesqgflerq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8pC (C:)
    manaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmn
    qadydrvcednrladgnvfsmpitldasqevidekklqaasritlrdfrddrnlailtid
    diyrpdktkeaklvfggdpehpaivylnntvkefyiggkieavnklnhydyvalrytpae
    lrvhfdklgwsrvvafqtrnpmhrahreltvraarsrqanvlihpvvgltkpgdidhftr
    vrayqallprypngmavlgllglamrmggpreaiwhaiirknhgathfivgrdhagpgsn
    skgedfygpydaqhavekykdelgievvefqmvtylpdtdeyrpvdqvpagvktlnisgt
    elrrrlrsgahipewfsypevvkilresnppratqgftifltgymnsgkdaiaralqvtl
    nqqggrsvslllgdtvrhelsselgftredrhtniqriafvateltragaaviaapiapy
    eesrkfardavsqagsfflvhvatplehceqsdkrgiyaaarrgeikgftgvddpyetpe
    kadlvvdfskqsvrsivheiilvlesqgflerq