PDB entry 1m7t

View 1m7t on RCSB PDB site
Description: Solution Structure and Dynamics of the Human-Escherichia coli Thioredoxin Chimera: Insights into Thermodynamic Stability
Class: electron transport
Keywords: chimera, human, E. coli, dynamics, stability, ELECTRON TRANSPORT
Deposited on 2002-07-22, released 2002-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chimera of Human and E. coli thioredoxin
    Species: Homo sapiens, Escherichia coli [TaxId:9606,562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-65)
      • engineered (61)
      • cloning artifact (106)
    • Uniprot P00274 (66-105)
    Domains in SCOPe 2.07: d1m7ta1, d1m7ta2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m7tA (A:)
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
daqdvapkygirgiptlllfkngevaatkvgalskgqlkefldanlv