PDB entry 1m7t

View 1m7t on RCSB PDB site
Description: Solution Structure and Dynamics of the Human-Escherichia coli Thioredoxin Chimera: Insights into Thermodynamic Stability
Deposited on 2002-07-22, released 2002-09-25
The last revision prior to the SCOP 1.67 freeze date was dated 2002-09-25, with a file datestamp of 2002-09-25.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1m7ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m7tA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    daqdvapkygirgiptlllfkngevaatkvgalskgqlkefldanlv