PDB entry 1m7n

View 1m7n on RCSB PDB site
Description: Crystal Structure of Unactivated APO Insulin-like Growth Factor-1 Receptor Kinase Domain
Deposited on 2002-07-22, released 2003-01-07
The last revision prior to the SCOP 1.71 freeze date was dated 2003-01-14, with a file datestamp of 2003-01-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1m7na_
  • Chain 'B':
    Domains in SCOP 1.71: d1m7nb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m7nA (A:)
    masvnpeyfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvai
    ktvneaasmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylr
    slrpemennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkig
    dfgmtrdiyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqp
    yqglsneqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemep
    gfrevsfyyseenklpepeeld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7nA (A:)
    saadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasm
    rerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpvlapp
    slskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyr
    kggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvme
    gglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m7nB (B:)
    masvnpeyfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvai
    ktvneaasmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylr
    slrpemennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkig
    dfgmtrdiyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqp
    yqglsneqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemep
    gfrevsfyyseenklpepeeld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m7nB (B:)
    saadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasm
    rerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpvlapp
    slskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyr
    kggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvme
    gglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk