PDB entry 1m7i

View 1m7i on RCSB PDB site
Description: crystal structure of a monoclonal fab specific for shigella flexneri y lipopolysaccharide complexed with a pentasaccharide
Class: immune system
Keywords: Fab-carbohydrate interactions; Shigella O-antigen; and anti-carbohydrate antibody, IMMUNE SYSTEM
Deposited on 2002-07-19, released 2003-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: light chain of the monoclonal antibody Fab SYA/J6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1M7I (0-214)
    Domains in SCOPe 2.06: d1m7ia1, d1m7ia2
  • Chain 'B':
    Compound: heavy chain of the monoclonal antibody Fab SYA/J6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1M7I (0-219)
    Domains in SCOPe 2.06: d1m7ib1, d1m7ib2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m7iA (A:)
    dvvltqtplslpvrlgdqasiscrssqsllhsdgntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqtthvptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m7iB (B:)
    evkveesggglvqpggsmklscvasgftfsnywmewvrqspekglewvaeirlksnnyat
    hyaesvkgrftisrddskssvylqmnnlraedtgiyyctrggavgamdywgqgtsvtvss
    atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
    fyslsslvtvpsstwpsqtvicnvahpaskvdlikepsgp