PDB entry 1m7d

View 1m7d on RCSB PDB site
Description: Crystal structure of a Monoclonal Fab Specific for Shigella flexneri Y Lipopolysaccharide complexed with a trisaccharide
Class: immune system
Keywords: Fab-carbohydrate interactions, Shigella O-antigen, anti-carbohydrate antibody, IMMUNE SYSTEM
Deposited on 2002-07-19, released 2003-07-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: light chain of the monoclonal antibody Fab SYA/J6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1M7D (0-214)
    Domains in SCOPe 2.03: d1m7da1, d1m7da2
  • Chain 'B':
    Compound: heavy chain of the monoclonal antibody Fab SYA/J6
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1M7D (0-219)
    Domains in SCOPe 2.03: d1m7db1, d1m7db2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m7dA (A:)
dvvltqtplslpvrlgdqasiscrssqsllhsdgntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqtthvptfgggtkleikradaaptvs
ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
stltltkdeyerhnsytceathktstspivksfnr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m7dB (B:)
evkveesggglvqpggsmklscvasgftfsnywmewvrqspekglewvaeirlksnnyat
hyaesvkgrftisrddskssvylqmnnlraedtgiyyctrggavgamdywgqgtsvtvss
atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpaskvdlikepsgp