PDB entry 1m6v

View 1m6v on RCSB PDB site
Description: crystal structure of the g359f (small subunit) point mutant of carbamoyl phosphate synthetase
Deposited on 2002-07-17, released 2002-07-31
The last revision prior to the SCOP 1.69 freeze date was dated 2002-07-31, with a file datestamp of 2002-07-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m6vA (A:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vA (A:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsame
    ivydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsac
    slpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvs
    katgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrst
    gevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldat
    hgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsal
    qykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m6vB (B:)
    miksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphi
    gnvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltr
    llrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltgg
    lpqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsn
    gpgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdv
    eknvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspfp
    hdaaplfdhfielieqyrktak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vB (B:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspaap
    lfdhfielieqyrkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m6vC (C:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vC (C:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsame
    ivydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsac
    slpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvs
    katgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrst
    gevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldat
    hgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsal
    qykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1m6vD (D:)
    miksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphi
    gnvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltr
    llrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltgg
    lpqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsn
    gpgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdv
    eknvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspfp
    hdaaplfdhfielieqyrktak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vD (D:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspaap
    lfdhfielieqyrkt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1m6vE (E:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vE (E:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsame
    ivydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsac
    slpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvs
    katgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrst
    gevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldat
    hgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsal
    qykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1m6vF (F:)
    miksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphi
    gnvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltr
    llrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltgg
    lpqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsn
    gpgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdv
    eknvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspfp
    hdaaplfdhfielieqyrktak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vF (F:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspaap
    lfdhfielieqyrkt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1m6vG (G:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvl
    ggrameivydeadlrryfqtavsvsndapvlldhflddavevdvdaicdgemvliggime
    hieqagvhsgdsacslpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevyli
    evnpraartvpfvskatgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkf
    pgvdpllgpemrstgevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdl
    aakllkqgfeldathgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgr
    raiedsrvirrsalqykvhydttlnggfatamalnadatekvisvqemhaqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vG (G:)
    mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
    adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
    daidkaedrrrfdvamkkigletarsgiahtmeealavaadvgfpciirpsftmggsggg
    iaynreefeeicargldlsptkellidesligwkeyemevvrdkndnciivcsienfdam
    gihtgdsitvapaqtltdkeyqimrnasmavlreigvetggsnvqfavnpkngrliviem
    nprvsrssalaskatgfpiakvaaklavgytldelmnditggrtpasfepsidyvvtkip
    rfnfekfagandrlttqmksvgevmaigrtqqeslqkalrglevgatgfdpkvslddpea
    ltkirrelkdagadriwyiadafraglsvdgvfnltnidrwflvqieelvrleekvaevg
    itglnadflrqlkrkgfadarlaklagvreaeirklrdqydlhpvykrvdtcaaefatdt
    aymystyeeeceanpstdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvn
    cnpetvstdydtsdrlyfepvtledvleivriekpkgvivqyggqtplklaraleaagvp
    vigtspdaidraedrerfqhaverlklkqpanatvtaiemavekakeigyplvvrpsame
    ivydeadlrryfqtavlldhflddavevdvdaicdgemvliggimehieqagvhsgdsac
    slpaytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvs
    katgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrst
    gevmgvgrtfaeafakaqlgsnstmkkhgrallsvregdkervvdlaakllkqgfeldat
    hgtaivlgeaginprlvnkvhegrphiqdrikngeytyiinttsgrraiedsrvirrsal
    qykvhydttlnggfatamalnadatekvisvqemhaqik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1m6vH (H:)
    miksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphi
    gnvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltr
    llrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltgg
    lpqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsn
    gpgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdv
    eknvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspfp
    hdaaplfdhfielieqyrktak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m6vH (H:)
    iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
    nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
    lrekgaqngciiagdnpdaalalekarafpglngmdlakevttaeayswtqgswtltggl
    pqakkedelpfhvvaydfgakrnilrmlvdrgcrltivpaqtsaedvlkmnpdgiflsng
    pgdpapcdyaitaiqkfletdipvfgiclghqllalasgaktvkmkfghhggnhpvkdve
    knvvmitaqnhgfavdeatlpanlrvthkslfdgtlqgihrtdkpafsfqghpeaspaap
    lfdhfielieqyrkt