PDB entry 1m57

View 1m57 on RCSB PDB site
Description: Structure of cytochrome c oxidase from Rhodobacter sphaeroides (EQ(I-286) mutant))
Deposited on 2002-07-08, released 2002-08-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-28, with a file datestamp of 2002-08-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.293
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m57A (A:)
    rgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglv
    kgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdm
    afprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifa
    vhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitml
    ltdrnfgttffqpsgggdpvlyqhilwffghpqvyiivlpafgivshviatfakkpifgy
    lpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwgg
    sielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgif
    agiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatw
    nfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtfeq
    lpkredw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m57B (B:)
    leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
    vparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgyey
    pdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvvq
    vtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvkv
    vseeayaawleqarggtyel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m57C (C:)
    ahaknhdyhilppsiwpfmasvgafvmlfgavlwmhgsgpwmgliglvvvlytmfgwwsd
    vvteslegdhtpvvrlglrwgfilfimsevmffsawfwsffkhalypmgpespiidgifp
    pegiitfdpwhlplintlillcsgcaatwahhalvhennrrdvawglalaialgalftvf
    qayeyshaafgfagniyganffmatgfhgfhvivgtifllvclirvqrghftpekhvgfe
    aaiwywhfvdvvwlflfasiyiwgq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m57D (D:)
    ghvagsmditqqektfagfvrmvtwaavvivaaliflalana
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m57G (G:)
    rgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglv
    kgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdm
    afprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifa
    vhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitml
    ltdrnfgttffqpsgggdpvlyqhilwffghpqvyiivlpafgivshviatfakkpifgy
    lpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwgg
    sielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgif
    agiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatw
    nfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtfeq
    lpkredw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m57H (H:)
    leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
    vparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgyey
    pdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvvq
    vtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvkv
    vseeayaawleqarggtyel
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m57I (I:)
    ahaknhdyhilppsiwpfmasvgafvmlfgavlwmhgsgpwmgliglvvvlytmfgwwsd
    vvteslegdhtpvvrlglrwgfilfimsevmffsawfwsffkhalypmgpespiidgifp
    pegiitfdpwhlplintlillcsgcaatwahhalvhennrrdvawglalaialgalftvf
    qayeyshaafgfagniyganffmatgfhgfhvivgtifllvclirvqrghftpekhvgfe
    aaiwywhfvdvvwlflfasiyiwgq
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m57J (J:)
    ghvagsmditqqektfagfvrmvtwaavvivaaliflalana