PDB entry 1m56

View 1m56 on RCSB PDB site
Description: Structure of cytochrome c oxidase from Rhodobactor sphaeroides (Wild Type)
Class: oxidoreductase
Keywords: Membrane Protein, OXIDOREDUCTASE
Deposited on 2002-07-08, released 2002-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.236
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c oxidase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33517
      • see remark 999 (435-438)
      • see remark 999 (517)
      • see remark 999 (519-520)
    Domains in SCOPe 2.07: d1m56a_
  • Chain 'B':
    Compound: cytochrome c oxidase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m56b1, d1m56b2
  • Chain 'C':
    Compound: cytochrome c oxidase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84153 (Start-265)
      • see remark 999 (29)
      • see remark 999 (91)
      • see remark 999 (243)
    Domains in SCOPe 2.07: d1m56c_
  • Chain 'D':
    Compound: cytochrome c oxidase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m56d_
  • Chain 'G':
    Compound: cytochrome c oxidase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33517
      • see remark 999 (435-438)
      • see remark 999 (517)
      • see remark 999 (519-520)
    Domains in SCOPe 2.07: d1m56g_
  • Chain 'H':
    Compound: cytochrome c oxidase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m56h1, d1m56h2
  • Chain 'I':
    Compound: cytochrome c oxidase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84153 (Start-265)
      • see remark 999 (29)
      • see remark 999 (91)
      • see remark 999 (243)
    Domains in SCOPe 2.07: d1m56i_
  • Chain 'J':
    Compound: cytochrome c oxidase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m56j_
  • Heterogens: CU, MG, CA, HEA, PEH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m56A (A:)
    madaaihghehdrrgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgv
    qfmcaehlesglvkgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfg
    nyfmplhigapdmafprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplst
    sesgystdlaifavhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlil
    lalpvlagaitmlltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivsh
    viatfakkpifgylpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptg
    ikifswiatmwggsielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahf
    hyvmslgavfgifagiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmp
    rryidypeafatwnfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlew
    tltspppehtfeqlpkredwerapah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m56A (A:)
    rgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglv
    kgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdm
    afprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifa
    vhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitml
    ltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgy
    lpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwgg
    sielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgif
    agiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatw
    nfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtfeq
    lpkredw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m56B (B:)
    qqqsleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhe
    krnkvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwyw
    gyeypdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnkt
    vvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympi
    tvkvvseeayaawleqarggtyel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m56B (B:)
    leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
    vparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgyey
    pdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvvq
    vtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvkv
    vseeayaawleqarggtyel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1m56C (C:)
    mahaknhdyhilppsiwpfmasvgafvmlfgavlwmhgsgpwmgliglvvvlytmfgwws
    dvvteslegdhtpvvrlglrwgfilfimsevmffsawfwsffkhalypmgpespiidgif
    ppegiitfdpwhlplintlillcsgcaatwahhalvhennrrdvawglalaialgalftv
    fqayeyshaafgfagniyganffmatgfhgfhvivgtifllvclirvqrghftpekhvgf
    eaaiwywhfvdvvwlflfasiyiwgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m56C (C:)
    ahaknhdyhilppsiwpfmasvgafvmlfgavlwmhgsgpwmgliglvvvlytmfgwwsd
    vvteslegdhtpvvrlglrwgfilfimsevmffsawfwsffkhalypmgpespiidgifp
    pegiitfdpwhlplintlillcsgcaatwahhalvhennrrdvawglalaialgalftvf
    qayeyshaafgfagniyganffmatgfhgfhvivgtifllvclirvqrghftpekhvgfe
    aaiwywhfvdvvwlflfasiyiwgq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1m56D (D:)
    madhshpahghvagsmditqqektfagfvrmvtwaavvivaaliflalana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m56D (D:)
    ghvagsmditqqektfagfvrmvtwaavvivaaliflalana
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1m56G (G:)
    madaaihghehdrrgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgv
    qfmcaehlesglvkgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfg
    nyfmplhigapdmafprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplst
    sesgystdlaifavhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlil
    lalpvlagaitmlltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivsh
    viatfakkpifgylpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptg
    ikifswiatmwggsielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahf
    hyvmslgavfgifagiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmp
    rryidypeafatwnfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlew
    tltspppehtfeqlpkredwerapah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m56G (G:)
    rgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglv
    kgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdm
    afprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifa
    vhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitml
    ltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgy
    lpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwgg
    sielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgif
    agiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatw
    nfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtfeq
    lpkredw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1m56H (H:)
    qqqsleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhe
    krnkvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwyw
    gyeypdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnkt
    vvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympi
    tvkvvseeayaawleqarggtyel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m56H (H:)
    leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
    vparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgyey
    pdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvvq
    vtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvkv
    vseeayaawleqarggtyel
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1m56I (I:)
    mahaknhdyhilppsiwpfmasvgafvmlfgavlwmhgsgpwmgliglvvvlytmfgwws
    dvvteslegdhtpvvrlglrwgfilfimsevmffsawfwsffkhalypmgpespiidgif
    ppegiitfdpwhlplintlillcsgcaatwahhalvhennrrdvawglalaialgalftv
    fqayeyshaafgfagniyganffmatgfhgfhvivgtifllvclirvqrghftpekhvgf
    eaaiwywhfvdvvwlflfasiyiwgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m56I (I:)
    ahaknhdyhilppsiwpfmasvgafvmlfgavlwmhgsgpwmgliglvvvlytmfgwwsd
    vvteslegdhtpvvrlglrwgfilfimsevmffsawfwsffkhalypmgpespiidgifp
    pegiitfdpwhlplintlillcsgcaatwahhalvhennrrdvawglalaialgalftvf
    qayeyshaafgfagniyganffmatgfhgfhvivgtifllvclirvqrghftpekhvgfe
    aaiwywhfvdvvwlflfasiyiwgq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1m56J (J:)
    madhshpahghvagsmditqqektfagfvrmvtwaavvivaaliflalana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m56J (J:)
    ghvagsmditqqektfagfvrmvtwaavvivaaliflalana