PDB entry 1m52

View 1m52 on RCSB PDB site
Description: Crystal Structure of the c-Abl Kinase domain in complex with PD173955
Class: transferase
Keywords: kinase, kinase inhibitor, pd173955, activation loop, transferase
Deposited on 2002-07-08, released 2002-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.211
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m52a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1m52b_
  • Heterogens: MES, P17, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1m52A (A:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m52A (A:)
    ydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmk
    eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissam
    eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl
    aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel
    mracwqwnpsdrpsfaeihqafetmfqessi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1m52B (B:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1m52B (B:)
    ydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmk
    eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissam
    eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl
    aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel
    mracwqwnpsdrpsfaeihqafetmfqessis