PDB entry 1m42

View 1m42 on RCSB PDB site
Description: Solution structure of apoCopC from Pseudomonas syringae
Class: metal binding protein
Keywords: cupredoxins, copper trafficking, METAL BINDING PROTEIN
Deposited on 2002-07-02, released 2002-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper resistance protein c
    Species: Pseudomonas syringae [TaxId:317]
    Gene: COPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1m42a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m42A (A:)
    hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
    gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk