PDB entry 1m3y

View 1m3y on RCSB PDB site
Description: the structure of major capsid protein of a large, lipid containing, dna virus
Deposited on 2002-07-01, released 2002-12-04
Made obsolete by 5tip on 2017-10-18

The last revision prior to the SCOP 1.65 freeze date was dated 2002-12-04, with a file datestamp of 2002-12-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.342
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m3yA (A:)
    tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
    tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
    krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
    wvdyifldtqertrfaqlpheylieqlqftgsetatpsattqasqnirlnfnhptkylaw
    nfnnptnygqytalanipgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqd
    rfatrkgsyfnkvqpyqsiggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyk
    tcsidatspaavlgntetvtantatlltalniyaknynvlrimsgmgglayan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m3yB (B:)
    tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
    tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
    krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
    wvdyifldtqertrfaqlpheylieqlqftgsetatpsattqasqnirlnfnhptkylaw
    nfnnptnygqytalanipgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqd
    rfatrkgsyfnkvqpyqsiggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyk
    tcsidatspaavlgntetvtantatlltalniyaknynvlrimsgmgglayan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m3yC (C:)
    tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
    tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
    krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
    wvdyifldtqertrfaqlpheylieqlqftgsetatpsattqasqnirlnfnhptkylaw
    nfnnptnygqytalanipgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqd
    rfatrkgsyfnkvqpyqsiggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyk
    tcsidatspaavlgntetvtantatlltalniyaknynvlrimsgmgglayan
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m3yD (D:)
    tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
    tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
    krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
    wvdyifldtqertrfaqlpheylieqlqftgsetatpsattqasqnirlnfnhptkylaw
    nfnnptnygqytalanipgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqd
    rfatrkgsyfnkvqpyqsiggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyk
    tcsidatspaavlgntetvtantatlltalniyaknynvlrimsgmgglayan