PDB entry 1m3g

View 1m3g on RCSB PDB site
Description: solution structure of the catalytic domain of mapk phosphatase pac-1: insights into substrate-induced enzymatic activation
Class: hydrolase
Keywords: catalytic domain, mapk phosphatase, pac-1, nmr, hydrolase
Deposited on 2002-06-27, released 2003-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dual specificity protein phosphatase 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q05923 (0-144)
    • engineered (87)
  Domains in SCOPe 2.08: d1m3ga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m3gA (A:)
  qggpveilpylflgscshssdlqglqacgitavlnvsascpnhfeglfryksipvednqm
  veisawfqeaigfidwvknsggrvlvhsqagisrsaticlaylmqsrrvrldeafdfvkq
  rrgvispnfsfmgqllqfetqvlch