PDB entry 1m2p

View 1m2p on RCSB PDB site
Description: Crystal structure of 1,8-di-hydroxy-4-nitro-anthraquinone/CK2 kinase complex
Class: transferase
Keywords: kinase, inhibitor-enzyme complex
Deposited on 2002-06-25, released 2003-06-17
The last revision prior to the SCOP 1.75 freeze date was dated 2003-06-17, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase II, alpha chain
    Species: Zea mays
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1m2pa_
  • Heterogens: HNA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m2pA (A:)
    skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
    ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
    tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
    eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
    kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
    ydhqerltaleamthpyfqqvraae