PDB entry 1m2j

View 1m2j on RCSB PDB site
Description: Sir2 homologue H80N mutant-ADP ribose complex
Class: gene regulation
Keywords: protein-ligand complex, gene regulation
Deposited on 2002-06-24, released 2003-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Silent Information Regulator 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28597 (0-244)
      • engineered (79)
      • cloning artifact (245-248)
    Domains in SCOPe 2.07: d1m2ja1, d1m2ja2
  • Heterogens: ZN, APR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1m2jA (A:)
mdekllktiaeskylvaltgagvsaesgiptfrgkdglwnryrpeelanpqafakdpekv
wkwyawrmekvfnaqpnkanqafaelerlgvlkclitqnvddlheragsrnvihlhgslr
vvrctscnnsfevesapkipplpkcdkcgsllrpgvvwfgemlppdvldramreveradv
iivagtsavvqpaaslplivkqrggaiieinpdetpltpiadyslrgkagevmdelvrhv
rkalslkln