PDB entry 1m2f

View 1m2f on RCSB PDB site
Description: Solution structure of the N-terminal domain of Synechococcus elongatus KaiA (KaiA135N); Family of 25 structures
Class: Circadian Clock Protein
Keywords: ALPHA-BETA-ALPHA SANDWICH, Circadian Clock Protein
Deposited on 2002-06-23, released 2002-11-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KaiA
    Species: Synechococcus elongatus [TaxId:32046]
    Gene: KaiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1m2fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m2fA (A:)
    mlsqiaiciwvestailqdcqralsadryqlqvcesgemlleyaqthrdqidclilvaan
    psfravvqqlcfegvvvpaivvgdrdsedpdepakeqlyhsaelhlgihqleqlpyqvda
    alaeflrlapvetma